spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software, spectramax i3 platform. Compact design. 315 can't find zero order. The SpectraMax Plus 384 reader is equipped with an innovation patented by Molecular Devices, the PathCheck® sensor, which measures the depth of a sample in a microplate by optical path length. Molecular Devices SpectraMax 384 Plus Microplate Reader. Insert the snorkel into the bottle and then insert the snorkel into the snorkel clamp. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes. Validate the optical performance of your absorbance . . Spectral Range. If no values are present, the water constant values are missing from the NVRAM. The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurements in the visible range. Total volume (except deep. When you do a read at wavelengths below 340 nm, you must use special UV-transparent, disposable or quartz plates to allow transmission of the deep UV spectra. Top detection is available for fluorescence detection on the SpectraMax M2, while top and bottom reads are possible on the SpectraMax M2 e. 0 nm increments. Top or bottom detection is available at the touch of a button. Top or bottom detection is available at the touch of a button. The SpectraMax® Paradigm® Multi-Mode Microplate Reader measures absorbance, fluorescence, time-resolved fluorescence (including HTRF), fluorescence polarization, AlphaScreen®, AlphaLISA®, and luminescence assays for up to 1536-well plates. , FI 45 sec. All have an optical pathlength of 1 cm (10 mm) and standard external dimensions (12. Title: SpectraMax i Series Multi-Mode Microplate Readers | Molecular Devices Author: Molecular Devices Subject: SpectraMax i Series offer the ideal solution for any application whether you are looking for an intuitive, easy-to-use reader, multi-user lab, or an upgradeable system that can adapt to support your lab s new projects. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. DNA provides the same sensitivity as a spectrophotometer. The excitation and the emission. Instrument design, user interface capabilities, and cost play key roles in purchasing a suitable microplate reader. SpectraMax 190 reads 96-well plates. Version7. The optical performance is comparable to a top-of-the-line dedicatedSpectraMax M Series Multi-Mode Microplate Readers 3. To rule out any nonspecific binding, an irrelevant human Fc-fusion protein control was used to test the hybridoma supernatants. SpectraMax i3x Multi-Mode Microplate Reader. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. Fixed a problem where Column Priority rather than AutoRead was available in the SpectraMax 384 instrument setup. It is an innovative way of normalizing the absorbance reading in a microplate well to that of a 1-cm cuvette. SpectraMax® Absorbance Microplate Readers can run both cuvette-based and microplate reader applications on the same instrument. SpectraMax® Plus 384 provides ultrafast, full spectral range. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. Keywords spectramax i3 multi-mode platform, spectramax i3, spectramax i3 system, scanlater western blot system, spectramax minimax imaging cytometer, softmax pro software, metamorph software. ) 8. Colorimetric assays. Service Contracts, Preventative Maintenance and Performance. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. The EMax® Plus Microplate Reader is designed to be a versatile and robust plate reader for research laboratories. The SpectraMax reader’s optical system mimics a dual-beam spectrophotometer. Detects signal from either fluorescence or luminescence based assays. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. For nearly 30 years, Molecular Devices has provided scientists with . The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. Manufacturer: Molecular Devices Model: SpectraMax Will included PC workstation w/ preloaded softmax pro software Wavelength Range: 340 – 850 nm Wavelength Selection: Monochromator, tunable 1. GeneBLAzer® Compatible Microplate Reader Documentation. SpectraMax™ Plus 384 VersaMax™The SpectraMax M2e is a dual-monochromator, multi-detection microplate reader with a dual-mode cuvette port and 96 or 384 microplate reading capability. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. 100 fmol 384-well (75 µL) 0. In this product video, see how the SpectraMax M5 quickly reads samples. Detection cartridge modularity allows for easy addition of new read modes within minutes without. 306 plate air cal. ability to detect 16 ng/well of DNA and to quantitate 50 ng of . The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a. This user guide provides detailed instructions on how to set up, run, and analyze the validation tests, as well as how to troubleshoot common issues. 0 nm increments Wavelength Bandwidth: 2 nm Wavelength Accuracy: < ± 2. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. SpectraMax® 340PC384 Microplate Reader for acquiring data in endpoint, kinetic, and spectral scan modes using wavelegths from 340-850 nm, tunable in 1 nm increments. 美谷分子 SpectraMax Plus 384 微孔板读 板机对于进行葡萄酒中苹果酸的酶学定量 检测是很好的一个选择，也可以扩展到类 似的实验，包括氨和挥发性酸度的测定。 这对于花费和时间都是高效的。 SpectraMax Plus 384 微孔板读板机的可 调谐和光径检测传感器特性有助于. Shaker time 0 to 999 seconds Temperature range Ambient +4°C to 45°C General specifications Dimensions (in. Charge heterogeneity with fast and simple CZE or with hi-res cIEF. With optimized reagents, option to operate the readers. To prevent such interference, select the Interlaced Reading option to read every other well in a checkerboard pattern in the first run and then read the previously omitted wells in a second run. It measures the optical density (OD) of samples in both 96- and 384-well. The control panel consists of a 2-x-20-character LCD and eleven pressure-sensitive membrane keys that can be used to control some functions of the instrument. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. used. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. 2 or higher, standard edition only, no GxP) VersaMax™ Microplate Reader (Serial numbers begining with BNxxxxx and BNRxxxxx are supported) SpectraMax® 190 Absorbance Microplate Reader (Serial numbers. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. All data were generated from at least three independent experiments (n ≥ 3). The SpectraMax 384 Plus lets you get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Corning® 384-well Flat Clear Bottom Black Polystyrene TC-treated Microplates, Low Flange, 20 per Bag, with Lid, Sterile Product Number 3764. 2. Page 6 SpectraMax Plus384, 190, 340PC384, and VersaMax Installation Guide Connecting Instrument Cables The power cord and USB cable connect to the ports on the rear of the instrument. both cuvette-based and microplate reader applications on the same instrument. Published Dec 16, 2020 | Updated May 19, 2023. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentrations. Multichannel optical design. Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. 6. Monochromator, tunable 1. Customize data collection and analysis. Digital controller and display. 384-well plate (75 µL): 10 fmol/well 1536-well plate (8 µL): 3 fmol/well 1 0200-7003 EX: 485/20 nm EM1: 535/20 nm EM2: 595/25 nm 384-well. Here, the CVs for each plate were less than 3, and the difference between mean onset time for the plates run on the two readers was only 7%. selected when SpectraMax Plus 384 was selected in the Preferences dialog. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. If using a microplate, place it in the drawer of the SPECTRAmax PLUS, then read the plate. 8 in. Narrow bandwidths deliver increased measurement accuracy and linearity over the widest range of assays, including. Get the best deals for spectramax plus 384 at eBay. With optimized reagents and the industry-leading data acquisition and analysis tool, SoftMax Pro® 7 Software, the SpectraMax® iD3. SpectraMax® Gemini™ EM Microplate Reader, Molecular Devices. Also refer to this Multimode Reader Comparison Chart. SpectraDrop High-Throughput Screening (HTS) Kit. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. 384-well microplate for use in time-resolved fluorescence, luminescence, Alpha, and radiometric assays. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . Applications. For more sample throughput, the system can be. With optimized reagents and the industry-leading data acquisition and analysis tool SoftMax® Pro 7 Software, the SpectraMax iD3 allows you to customize your workflow to. Multimode Reader Comparison Chart. 8 (W) x 15 (D)This SpectraMax Plus 384 Spectrophotometer has been sold, but you can view our other spectrophotometers currently available for purchase here: Plus384, 190, 340PC384, and VersaMax Installation Guide Author: Molecular Devices Subject: Installation Guide Keywords: SpectraMax Versa and others Detection Platform Created Date: 5/17/2023 2:14:27 PMOn SpectraMax L, 1 RLU = 1 count per second for photon counting mode only. If values are present, then. For more sample throughput, the system can be. The Molecular Devices SpectraMax 384 Plus is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. With optimized reagents, option to operate the. Product Specs; Item SpectraMax Plus 384 Spectrophotometer; Company Molecular Devices LLC; This product is no longer available on Biocompare. SpectraMax i3x. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. An ATP standard curve spanning five decades was run using the ATPlite 1step Luminescence Assay System (PerkinElmer) on the SpectraMax iD3 reader. Both the SpectraMax M5 and the Gemini EM are monochromator-based, microplate readers. For more information, please visit us at SpectraMax® M2/M2e microplate readers for use with the Transcreener® FI Assays. . The narrow bandwidths used by the model increase measurement accuracy and linearity over a wide range. SpectraMax® iD3, iD5, ABS, and ABS Plus readers, and up to 2. o SpectraMax M2 - Absorbance spectrum wavelength value change problem has been fixed. Detection cartridge modularity allows for easy addition of new read modes within minutes without. With optimized reagents, option to operate the. 5 mP 3 mP 1536-well (8 µL) 1. Reads from 190 to 1000 nm range across various vessels. 190-1000 nm. Absorbance = E * C * L. Temperature range between 4°C above ambient to 45°C. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). You manually lift up the lid over the chamber to insert or remove a cuvette. For more sample throughput, the system can be. SpectraMax® M2 Multi-Mode Microplate Reader MLDVM2 SpectraMax® M2e Multi-Mode Microplate Reader (top and bottom reading) MLDVM2E SpectraMax® M3 Multi-Mode Microplate Reader MLDVM3 Ordering information VWR cat. Capture flash assays with ease Expand your lab’s capabilities to include flash applications such as dual luciferase and ATP assays with the SpectraMax iD3 injector system with SmartInject™ Technology ensuring equal mixingThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Details. Using the patented PathCheck® Pathlength Measurement Technology, the SpectraMax M4 Microplate Reader transforms each well in a microplate to a fixed. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell-based assays. 020 fmol 0. Each sample has a discrete sample beam and reference beam. Transcreener® HTS is a universal, high throughput biochemical assay platform based on the detection of nucleotides, which are formed by thousands of cellular enzymes—many of which catalyze the covalent regulatory. The SpectraMax® Multi-Mode Microplate Reader provide great flexibility and include. The SpectraMax L reader is upgradeable to dual-channel configurations for a 2-fold. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. Abs 49 sec. Handles plates with up to 384 wells. Product Specs. 6-, 12-,. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. BioRAPTR FRD Microfluidic Workstation and SpectraMax Paradigm Multi-Mode Detection Platform” PART NUMBER: 0200-7017 0200-7018 0200-7019 (384 Std) (384 HTS) (1536 HTS) Plate 96, 384 96, 384 96, 384, formats 1536 Typical 4 min/ 384 2 min/384 8 min/1536 Throughput plate plate plate Fully enabled protocols = reduced setup timeThe SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. spectraMax 340pc 384 Microplate reader. 190-1000 nm. 5 cm x. SpectraMax M3, M4, M5, and M5e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 과 같은 Parameter를 검사하여 평가할 수 있습니다. used. to View Figures. Our absorbance plate readers feature our PathCheck Sensor technology and. The SpectraMax® ABS Plus Microplate Reader can run . com. Experienced in operating and performing maintenance on numerous laboratory instrumentation from various large and small manufacturers including Spectramax 384 and i3 with Softmax software. 10822 512. In addition, the iD5 reader can measure TRF and FP, and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter gene detection with syringe and Western blot detection. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Cell viability는 세포막 Integrity 또는. 1, All Necessary Cables and Cords, Manuals. In addition, users can define individual reagents and concentrations to be delivered to eachMolecular Devices Microplate Reader Spectramax 384 340PC. Molecular Devices Spectramax 384 Plus Microplate Reader is available from The Lab World Group. Compare. . Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Contact Us Phone: +1-800-635-5577 Web: Email: [email protected] are some cuvettes that have been tested in the M5 and Plus 384. Also for: Spectramax plus. Now you can run both standard spectrophotometer and microplate reader applications on the same instrument. We would like to show you a description here but the site won’t allow us. 003 fmol 0. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. This white, polystyrene ProxiPlate™ has shallow wells allowing for lower volumes to be used in assays. The Analyst®, FlexStation® and SpectraMax® M5/M5 e from Molecular Devices have received the LanthaScreen® Certified designation from Life Technologies which ensures that these readers are validated to strict standards in instrument setup and assay performance. PathCheck sensor corrects optical pathlength & pipetting variation. The standard 8 filter modes enable endpoint and kinetic applications such as protein quantification, cell viability and ELISA. On the front panel of the instrument, press the load/eject button to move the microplate drawer outside of the instrument. The SpectraMax i3x reader measures spectral-based absorbance, fluorescence, and luminescence with the added functionality of modular upgrades for western blot, imaging, and fast kinetics with injectors. Assay Performance with Various Instrument Settings The SpectraMax® M2/M2e instruments use SoftMaxPro® DataSpectraMax® Microplate Readers and SoftMax® Pro Software. In case of a cuvette, the optical path is horizontal, hence. 312 gain calibration failed. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. Our microplateSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Read one sample or up to 384 at a time – it’s your choice. spr SpectraMax M2 M2e M3 M4 M5 M5e SpectraTest ABS2 v2. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. Data of selected analytes in the graphs below illustrate sample correlations between 96-well and 384-well format of 16 human plasma samples. The Spectramax 384Plus is a microplate spectrofluorometer from Molecular Devices. Microplate Readers include the M3, M4,. UV/Vis spectrophotometer & microplate reader with built-in cuvette port. Published Dec 16, 2020 | Updated Dec 16, 2020. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. There should be a value for 900 and 1000. the SpectraMax iD3 is a fantastic plate reader for a wide range of. 96 , 384 , and 1536 well microplates Note: Detection Cartridges and PC not included. Optimized for 96- and 384-well plates, the Multi-Mode Detection Cartridge provides a broad array of measurement capabilities: Fluorescence Intensity (FI), Time. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. Fluorescence Microplate Reader Comparison Chart. Community forums for Molecular Devices - SpectraMax 340PC384 Microplate Reader relating to Fatal Error 401 on LabWrench. For more sample throughput, the system canTo provide access to disconnect power from the instrument, maintain a 20 cm to 30 cm (7. Application note showing how SpectraMax® i3x and SpectraMax®iD5 Multi-Mode Microplate Readers are used to performGq-coupled receptor assays using HTRF technology. Categories:. In the M2, M5 and Plus 384, the light. It measures the optical density (OD) of samples in both 96- and 384-well. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Abs 49 sec. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. flat meniscus), but is approx 15 mL. . </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. Capabilities include fluorescence and luminescence readings, environmental control, cell viability assays, enzyme. Normally this fluorometric assay is performed in 96-well microplates. Check the optical alignment, you will have to disassemble and remove optical cover. SpectraMax340PC384reads96-wellplatesand384-wellplates. 384 wells) and the "Select Specific" menu to choose the specific plate type. 100 fmol 384-well (75 µL) 0. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The SpectraMax® iD3 and iD5 Multi-Mode Microplate Readers measure absorbance, fluorescence, and luminescence. It may be named "Pothos". The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. spr SpectraMax Plus 384. The SpectraMax M4 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96 and 384-well microplates. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. Absorbance: For wavelengths in the visible range, 340 nm and above, clear polystyrene plates are recommended. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Molecular Devices SpectraMax Plus 384. 100 fmol 1536-well (8 µL) 0. SpectraMax® iD5 Multi-Mode Microplate Reader - Five-Mode Hybrid Microplate Reader with Automatic NFC Filter Identification and Western Blot Capability, Molecular Devices. ELISAs/EIAs. . This user guide provides detailed instructions, troubleshooting tips and technical specifications for these instruments. Flexible Throughput Read one sample or up to 384 at a time – it’s your choice. Set up SoftMax Pro Software to use PathCheck as detailed above. Description: The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research. Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. plates < 100 amol (384-well) 1. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. 2. Optimal volumes are usually stated as 'working volume', which is 25 - 90 mL. The instrument reads any standard cuvette, microcuvette, test tube or 96- and 384-well standard or UV transparent microplate over a full 190 to 1000 nm. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. The Molecular Devices SpectraMAX absorbance microplate readers mimic a dual beam spectrophotometer with a patented multichannel optical design. Sold as-is. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. Fluorescent Polarization: Solid black plates, as above. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. With the QuickSync client installed on your computer, your SpectraMax iD3 reader can push data to any computer within the same network. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. This reader also makes use of a unique temperature. Operators can conveniently select up to six wavelengths at a time for absorbance detection in the visible wavelength range of 340 nm – 850 nm. where. 00 USD BMG FLUOstar Omega Microplate Reader Unit2 - AV $10,295. the SpectraMax iD3 is a fantastic plate reader for a wide range of assays. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. no. 020 fmol 0. Regularly used for NADPH ATPase assays, and BCA assays. Features. . Ensure there are three inches between the back of the instrument and any other objects or surfaces so it has proper air flow. 4% in white 96- and 384-well microplates Sensitivity (ATP-Glow) Optimized 96 wells 3 pM 384 wells 6 pM. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. Read one sample or up to 384 in a single plate eead using any standard cuvette, or 96-or 384-well microplate. 5 pM 384-well (50 µL) 6 pM 10 pM 1536-well (8 µL) 19 pM 25 pM 0200-7015 (LUM 384) Optimized Guaranteed* 96-well (200 µL) 1. Temperature control. 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Typical applications for this powerful reader include DNA and RNA quantification. Expanded dynamic range Engineered for performance with spectral fusion illumination for increased sensitivity across the entire excitation range. 190-1000 nm, tunable in 1 nm increments. Detection modalities are shown in Table 1-1. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. If using test tubes, read the absorbance of each tube in the cuvette port of the SPECTRAmax PLUS microplate spectrophotometer. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. It. SpectraMax® Plus 384 Absorbance Plate Reader, Molecular Devices. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. 5 pM 2. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. 0200-6263. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. Expand your research capabilities to include flash-based applications, including dual luciferase and ATP assays. General-purpose refrigerators are ideal economical units for when precise temperature control and maintenance are not. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. Download PDF versions of the SpectraMax Microplate Reader User Guides. Features. SPECTRAmax® PLUS384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. Made from polypropylene with conical well profiles to maximize recovery and allow working with sample volumes as low as 5 µl. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. microplates or in a cuvette at a. The SpectraMax. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. The optical performance is comparable to a top-of-the-line dedicated Unparalleled performance on a personalized platform. Note: Additional readers with similar performance are listed. Tb donor/red acceptor. Molecular Devices UVmax Kinetic Microplate Reader. Double-click the unknown device with the yellow warning icon. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in absorbance, fluorescence, luminescence, time-resolved fluorescence (TRF), and tunable fluorescence polarization (FP) read modes. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. Perform the following steps to install the drivers: Start > Control Panel > System. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2e. Biocompare is the leading resource for up-to-date product information, product reviews, and new technologies for life scientists. Wavelength Selection. Alpha 384 STD 96- and 384-well . 6 to 384-well plates, LVis Plate with sixteen 2 µL microspots; Get Quote. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. 1. The 190 can read across the entirety of the UV-Vis. With the SpectraMax® MiniMax™ 300 Imaging Cytometer, industry-leading SoftMax® Pro Software, and user. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. Biocompare is the leading. SPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. Act quickly! These items have limited quantity and availability. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. SpectraMax® i3 Multi-ModeDetectionPlatform withtheSpectraMax® MiniMax™ImagingCytometer UserGuide 5025027A April2013. ester flash assays, in both 96- and 384-well plates. More Product Information. The SpectraTest ABS1 plate is a reliable and. Open the catalog to page 2. SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. Figure 1. A microplate reader as The SpectraMax® i3x Multi-Mode Microplate Reader measures absorbance, fluorescence, and luminescence with available upgrades including western blot, cell imaging, and fast kinetics with injectors plus additional detection modes. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. Use any standard cuvette, 12 x 75 mm test tube, 96- or 384-well. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. You can use 6, 12, 24, 48, 96, and 384-well plates that conform to ANSI/SBS standard microplate footprint and dimensions in the instrument. Below is the list of Molecular Devices microplate readers and liquid handling instruments that are of out-of-production and are now considered obsolete. 9. SpectraMax iD5; SpectraMax Mini; SpectraMax Mini Install Guide; SpectraMax Mini Reader Plug-In Download Page (required for SoftMax Pro 7. PathCheck Sensor. Page 1The Molecular Devices SpectraMax M2 Microplate Reader is a multidetection microplate reader with dualmonochromators, dual-mode cuvette ports, and top-reading capability. The plate reader optics are tunable for absorbance, fluorescence intensity, fluorescence polarization, and time resolved fluorescence assays (TRF). Includes: Computer Loaded with SoftMax Pro 5. E = absorptivity (extinction coefficient) C = concentration = pathlength. Slide the tip into the nozzle, the slots are labeled 1 and 2 for injector 1 and injector 2. However, for greater flexibility, some instruments can accommodate 6- to 1536-well plate formats. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM.